research chemical comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2025-09-12. Where a claim depends on a specific study, the study is described rather than over-claimed.
Analytical chemists detect SR9009 with liquid chromatography-tandem mass spectrometry, commonly abbreviated LC-MS/MS. Sample preparation may involve protein precipitation, liquid-liquid extraction, or solid-phase extraction before analysis. Laboratories can target the parent compound or its metabolites, depending on the matrix and the purpose of testing. Anti-doping methods require sensitive and specific assays because concentrations in biological samples can be low. Reference standards and validated methods are essential for reliable identification and quantification.
Regulatory agencies have not approved SR9009 for human therapeutic use. It is typically sold as a research chemical with labels stating that it is not for human consumption. The World Anti-Doping Agency prohibits the substance in sport, generally under the category of non-approved substances. Customs and national laws may restrict importation, sale, or possession. Product quality and legal status can vary by country and vendor, and therapeutic claims are not permitted in regulated advertising because the compound lacks approval.
Several misconceptions surround SR9009. It is often described as a SARM, a steroid, or an exercise pill, but its known target is the REV-ERB receptor family. Rodent studies have examined exercise capacity and metabolic markers, yet human outcomes remain unproven. Oral bioavailability appears low in animals, and human pharmacokinetics are not well characterized. Online products may contain impurities or different compounds, so identity and purity testing are important for research use.
Physicochemical behavior influences handling. SR9009 is described as a solid with limited aqueous solubility, so organic solvents such as dimethyl sulfoxide or ethanol are common in research stock solutions. Aqueous dilution can produce precipitates if the organic content is too low. Light, heat, and repeated freeze-thaw cycles may affect stability. Storage recommendations usually specify a desiccated freezer environment protected from light, but exact stability data depend on the formulation and matrix.
Detection in biological samples can be complicated by rapid metabolism and low circulating concentrations. Some studies report phase I and phase II metabolites, and analytical methods may need to target those species in addition to the parent compound. Immunoassays are not broadly available, so mass spectrometry remains the main confirmatory approach. For anti-doping testing, laboratories look for SR9009 and its metabolites using validated LC-MS methods. Open questions include how long metabolites remain detectable and how different routes of administration alter detection windows.
In laboratory settings, SR9009 is typically characterized by liquid chromatography–mass spectrometry (LC-MS) or high-performance liquid chromatography with ultraviolet detection (HPLC-UV). These methods can confirm identity and estimate purity, but they require reference standards for accurate quantification. Because SR9009 is not a licensed pharmaceutical, no harmonized pharmacopeial monograph exists. Laboratories often validate in-house methods for matrices such as plasma, urine, or cell culture media. Sample preparation may involve protein precipitation or liquid-liquid extraction before analysis.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved for human use | Research-use-only status in many markets |
| WADA status | Prohibited in sport | Generally listed as a non-approved substance |
| Detection technique | LC-MS/MS | Common for urine and blood analysis |
| Common alias | Stenabolic | Informal market nickname, not a pharmacopoeial name |
| Purity check | HPLC or LC-UV | Independent certificate of analysis is typical |
Analytical methods for SR9009 typically rely on liquid chromatography coupled with tandem mass spectrometry. The technique can separate the parent compound from related substances and detect low concentrations in biological matrices. Urine and blood are common samples in anti-doping testing, while in vitro studies may use cell culture media. Rapid metabolism and low expected concentrations make method validation important for reliable identification. Exact metabolite patterns can vary by species and are not fully mapped.
Regulatory treatment of SR9009 reflects its investigational status. The compound has no approved human therapeutic indication, and sports authorities prohibit its use. It appears on anti-doping lists as a non-approved substance or metabolic modulator, depending on the list version. Products sold online as research chemicals are not quality-controlled medicines, so their identity and purity can differ from the label. Such products may also contain unlisted compounds, which complicates both testing and safety assessment.
Scientific discussion of SR9009 often separates animal evidence from human anecdote. Rodent studies provide controlled data on endurance, metabolism, and gene expression, but they use specific strains, doses, and treatment durations. Human reports are mostly uncontrolled and cannot establish cause and effect. Open questions include oral bioavailability, tissue distribution, metabolic stability, and long-term effects. Review articles generally call for more rigorous pharmacokinetic and safety research before any clinical use could be considered.
In laboratory settings, SR9009 is commonly identified by its molecular structure and its interaction with REV-ERB receptors. Vendors may list it under synonyms such as Stenabolic or REV-ERB agonist, but those names do not define purity or identity. Analytical confirmation typically uses high-performance liquid chromatography with ultraviolet detection or liquid chromatography–mass spectrometry. A reference standard is needed to compare retention time and mass spectrum, because the compound can be confused with related research chemicals.
Handling practices for SR9009 focus on minimizing degradation and contamination. The solid is generally stored desiccated at or below -20 °C, protected from light and moisture. Stock solutions are often prepared in dimethyl sulfoxide or ethanol, then aliquoted to avoid repeated freeze–thaw cycles. Aqueous solubility is low, so formulations for animal studies may require cosolvents or suspending agents. Personnel should follow institutional chemical safety procedures, because toxicological data for humans are incomplete.
Regulatory status varies by country and intended use. Major drug agencies have not granted marketing authorization for SR9009 as a medicine, and it is not listed as a controlled substance in many jurisdictions. It is often sold as a research chemical, a category that may fall outside pharmaceutical manufacturing rules. Buyers should verify local laws and supplier documentation, including certificates of analysis. The lack of standardized quality controls raises concerns about identity, purity, and actual content in products marketed online.
==== Exocytosis ==== Exocytosis is the process by which a cell transports molecules such as neurotransmitters and proteins out of the cell. As an active transport mechanism, exocytosis requires the use of energy to transport material. Exocytosis and its counterpart, endocytosis, the process that brings substances into the cell, are used by all cells because most chemical substances important to them are large polar molecules that cannot pass through the hydrophobic portion of the cell membrane by passive transport. Exocytosis is the process by which a large amount of molecules are released; thus it is a form of bulk transport. Exocytosis occurs via secretory portals at the cell plasma membrane called porosomes. Porosomes are permanent cup-shaped lipoprotein structures at the cell plasma membrane, where secretory vesicles transiently dock and fuse to release intra-vesicular contents from the cell. In the context of neurotransmission, neurotransmitters are typically released from synaptic vesicles into the synaptic cleft via exocytosis; however, neurotransmitters can also be released via reverse transport through membrane transport proteins.
=== Jordan: Bring Out The Boar === First Aired: 23 December 2010 Meet Jordan, a loud mouthed bully who calls himself the boar. He makes life miserable for twins, Austin & Micah, since one of them is going to nursing school. His real name is Jordan Rush. The bad part of it is that he's a cop's son, so he says he's "At the Top of the Food Chain". So Mayhem brings in MMA Fighter Joe Riggs with a record of 34 wins and 12 losses, to teach Jordan a lesson. In the first round, he tapped out five times. During the second round, Joe finished Jordan off via TKO. Austin and Micah won $10,000. After the fight, a humbled Jordan apologized for his behavior.
=== Etymology and terminology === The origin of the term dry needling is attributed to Janet G. Travell. In her 1983 book, Myofascial Pain and Dysfunction: Trigger Point Manual, Travell uses the term dry needling to differentiate between two hypodermic needle techniques when performing trigger point therapy. However, Travell did not elaborate on the details of the dry needling techniques: the injection of a local anesthetic and the mechanical use of a hypodermic needle without injecting a solution. The current techniques were based on traditional and Western medical acupuncture.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Sources: en.wikipedia.org
== Epidemiology == Approximately 34% of people with diabetes (Type 1 or Type 2 diabetes) will develop a foot ulcer in their lifetime. 18.6 million people worldwide will develop a foot ulcer each year. 15-20% of moderately to severely infected foot ulcers eventually lead to amputation, and the mortality rate of diabetic foot ulcers is 30% at 5 years with a mortality rate of 70% in those with a foot ulcer who receive an above the foot amputation. Foot ulcers and amputations are associated with a reduced quality of life. In the United States, Black people, Native Americans, Hispanics, and those living in rural areas or those with a lower socioeconomic status have an increased rate of amputations due to diabetic foot ulcers. Approximately 8.8 percent of hospital admissions of diabetic patients are for foot-related problems, and such hospital admissions are about 13 days longer than for diabetics without foot-related admissions. Approximately 58% of ulcers recur within 3 years and up to 65% recur within 5 years, sometimes at a different location that the original ulcer. Diabetic foot disease is the leading cause of non-traumatic lower limb amputations.
== Other uses == Adult Nurse Practitioner Aircraft Nuclear Propulsion Lee Airport, Annapolis, Maryland, US (IATA airport code and FAA location identifier "ANP") Angika language (ISO language code "anp") Absolut Null Punkt, a Japanese band featuring KK Null Anpao or Anp, the two-faced Lakota god of the dawn in Native American mythology Aviação Naval Portuguesa or Portuguese Naval Aviation
6 April – The new England women's national football team home kit is worn for its inaugural match as England participates in the 2023 Women's Finalissima against Brazil. At Wembley Stadium, England beat Brazil 4–2 in a penalty shootout to win their first Finalissima. 8 April – The NASUWT is to ballot its members on strike action after 87% of those who voted rejected the government's pay offer for teachers in England, which the union says fails to address concerns over pay and conditions. 11 April – Junior doctors in England begin a four-day strike. 14 April – Two police officers are dismissed from the Metropolitan Police over offensive WhatsApp messages, some of them including offensive comments about model Katie Price's son, Harvey. The Royal College of Nursing rejects a pay offer for nurses in England and announces a 48-hour strike from 8pm on 30 April to 8pm on 2 May. UNISON confirms its members working for the NHS have voted unanimously to accept a 5% pay offer from the UK government. Following a trial at Derby Crown Court, Stephen Boden and partner Shannon Marsden are convicted of the murder of their ten-month-old son Finley Boden on Christmas Day 2020, 39 days after he had been returned to them by social services. 15 April – Merseyside Police say that 118 people have been arrested at Aintree Racecourse after protestors delay the start of the 2023 Grand National. The race, which is delayed by 14 minutes, is won by Corach Rambler, ridden by Derek Fox.
Sources: en.wikipedia.org
Legality depends on the country and the intended use. In many places it is not approved as a medicine and may be sold only as a research chemical. Importation or possession can be restricted, and sports organizations prohibit it.
Anti-doping laboratories typically use LC-MS/MS to detect SR9009 or its metabolites in urine or blood. The exact assay depends on the laboratory and the testing program. Detection can be challenging because the compound may be rapidly metabolized and present at low levels.
Stenabolic is an informal nickname used in online fitness and research-chemical markets, not an official drug name. It likely references reported effects on endurance in rodent studies. The nickname does not imply approval or proven human benefit.
It is usually detected by LC-MS or HPLC-UV against a reference standard. In biological matrices, metabolite targeting can improve detection. No universal immunoassay is widely available.